DBNL polyclonal antibody
  • DBNL polyclonal antibody

DBNL polyclonal antibody

Ref: AB-PAB21286
DBNL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DBNL.
Información adicional
Size 100 uL
Gene Name DBNL
Gene Alias ABP1|HIP-55|SH3P7
Gene Description drebrin-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq INWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANYSFHKESGRFQDVGPQAPVGSVYQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DBNL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 28988
Iso type IgG

Enviar un mensaje


DBNL polyclonal antibody

DBNL polyclonal antibody