METTL16 polyclonal antibody
  • METTL16 polyclonal antibody

METTL16 polyclonal antibody

Ref: AB-PAB21280
METTL16 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant METTL16.
Información adicional
Size 100 uL
Gene Name METTL16
Gene Alias METT10D
Gene Description methyltransferase like 16
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DERSEEKGGVEVLESCQGSSNGAQDQEASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human METTL16.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79066
Iso type IgG

Enviar un mensaje


METTL16 polyclonal antibody

METTL16 polyclonal antibody