RAD21 polyclonal antibody
  • RAD21 polyclonal antibody

RAD21 polyclonal antibody

Ref: AB-PAB21266
RAD21 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAD21.
Información adicional
Size 100 uL
Gene Name RAD21
Gene Alias FLJ25655|FLJ40596|HR21|HRAD21|KIAA0078|MCD1|NXP1|SCC1|hHR21
Gene Description RAD21 homolog (S. pombe)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq KLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPREDQQQQHQQRDVIDEPIIEEPSRLQESVMEASRTNIDESAMPPPPPQGVKRKAGQIDPEPVMPPQQVEQMEIPPVEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RAD21.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5885
Iso type IgG

Enviar un mensaje


RAD21 polyclonal antibody

RAD21 polyclonal antibody