OGDH polyclonal antibody
  • OGDH polyclonal antibody

OGDH polyclonal antibody

Ref: AB-PAB21263
OGDH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OGDH.
Información adicional
Size 100 uL
Gene Name OGDH
Gene Alias AKGDH|E1k|OGDC
Gene Description oxoglutarate (alpha-ketoglutarate) dehydrogenase (lipoamide)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq FRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OGDH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4967
Iso type IgG

Enviar un mensaje


OGDH polyclonal antibody

OGDH polyclonal antibody