PTRHD1 polyclonal antibody
  • PTRHD1 polyclonal antibody

PTRHD1 polyclonal antibody

Ref: AB-PAB21257
PTRHD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PTRHD1.
Información adicional
Size 100 uL
Gene Name PTRHD1
Gene Alias C2orf79
Gene Description peptidyl-tRNA hydrolase domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GRMRKVVLEAPDETTLKELAETLQQKNIDHMLWLEQPENIATCIALRPYPKEEVGQYLKKFRLFK
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PTRHD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 391356
Iso type IgG

Enviar un mensaje


PTRHD1 polyclonal antibody

PTRHD1 polyclonal antibody