FIT1 polyclonal antibody
  • FIT1 polyclonal antibody

FIT1 polyclonal antibody

Ref: AB-PAB21249
FIT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FIT1.
Información adicional
Size 100 uL
Gene Name FIT1
Gene Alias MGC46490
Gene Description fat-inducing transcript 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTF
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FIT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 161247
Iso type IgG

Enviar un mensaje


FIT1 polyclonal antibody

FIT1 polyclonal antibody