ENTHD1 polyclonal antibody
  • ENTHD1 polyclonal antibody

ENTHD1 polyclonal antibody

Ref: AB-PAB21241
ENTHD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ENTHD1.
Información adicional
Size 100 uL
Gene Name ENTHD1
Gene Alias FLJ25421|dJ370M22.3
Gene Description ENTH domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SHISSSHWGEFSTQNVDQFIPLSCSGFQSTKDFPQEPEAKNSISVLLREVKRAIARLHEDLSTVIQELNVINNILMSMSLNSSQISQSSQVP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ENTHD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 150350
Iso type IgG

Enviar un mensaje


ENTHD1 polyclonal antibody

ENTHD1 polyclonal antibody