GCN1L1 polyclonal antibody
  • GCN1L1 polyclonal antibody

GCN1L1 polyclonal antibody

Ref: AB-PAB21227
GCN1L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GCN1L1.
Información adicional
Size 100 uL
Gene Name GCN1L1
Gene Alias GCN1|GCN1L|KIAA0219
Gene Description GCN1 general control of amino-acid synthesis 1-like 1 (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ALKEKLGTPDEQLEMANCQAVILSVEDDTGHRIIIEDLLEATRSPEVGMRQAAAIILNIYCSRSKADYTSHLRSLVSGLIRLFNDSSPVVLEESWDALNAITKKLDAGNQLALIEELHKEIRLIGNESKGEHVPGFC
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GCN1L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10985
Iso type IgG

Enviar un mensaje


GCN1L1 polyclonal antibody

GCN1L1 polyclonal antibody