HEMGN polyclonal antibody
  • HEMGN polyclonal antibody

HEMGN polyclonal antibody

Ref: AB-PAB21222
HEMGN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HEMGN.
Información adicional
Size 100 uL
Gene Name HEMGN
Gene Alias EDAG|EDAG-1
Gene Description hemogen
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGI
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HEMGN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55363
Iso type IgG

Enviar un mensaje


HEMGN polyclonal antibody

HEMGN polyclonal antibody