SLC35F1 polyclonal antibody
  • SLC35F1 polyclonal antibody

SLC35F1 polyclonal antibody

Ref: AB-PAB21221
SLC35F1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC35F1.
Información adicional
Size 100 uL
Gene Name SLC35F1
Gene Alias C6orf169|FLJ13018|dJ230I3.1
Gene Description solute carrier family 35, member F1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RVYKQFRNPSGPVVDLPTTAQVEPSVTYTSLGQETEEEPHVRVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC35F1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 222553
Iso type IgG

Enviar un mensaje


SLC35F1 polyclonal antibody

SLC35F1 polyclonal antibody