COBL polyclonal antibody
  • COBL polyclonal antibody

COBL polyclonal antibody

Ref: AB-PAB21192
COBL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant COBL.
Información adicional
Size 100 uL
Gene Name COBL
Gene Alias DKFZp686G13227|KIAA0633|MGC131893
Gene Description cordon-bleu homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human COBL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23242
Iso type IgG

Enviar un mensaje


COBL polyclonal antibody

COBL polyclonal antibody