C21orf56 polyclonal antibody
  • C21orf56 polyclonal antibody

C21orf56 polyclonal antibody

Ref: AB-PAB21191
C21orf56 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C21orf56.
Información adicional
Size 100 uL
Gene Name C21orf56
Gene Alias DKFZp434N0650|MGC99490
Gene Description chromosome 21 open reading frame 56
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SQAPFKAFLSPPEPHSHRGTDRKLSPLLSPLQDSLVDKTLLEPREMVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLDRRILAYVFPGVTRLYGFTV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C21orf56.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84221
Iso type IgG

Enviar un mensaje


C21orf56 polyclonal antibody

C21orf56 polyclonal antibody