MOV10L1 polyclonal antibody
  • MOV10L1 polyclonal antibody

MOV10L1 polyclonal antibody

Ref: AB-PAB21186
MOV10L1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MOV10L1.
Información adicional
Size 100 uL
Gene Name MOV10L1
Gene Alias DJ402G11.8|DKFZp434B0717|FLJ33421
Gene Description Mov10l1, Moloney leukemia virus 10-like 1, homolog (mouse)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EYISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEFTYNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQSTSKKNRKTMTDQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MOV10L1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54456
Iso type IgG

Enviar un mensaje


MOV10L1 polyclonal antibody

MOV10L1 polyclonal antibody