TMEM150 polyclonal antibody
  • TMEM150 polyclonal antibody

TMEM150 polyclonal antibody

Ref: AB-PAB21184
TMEM150 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM150.
Información adicional
Size 100 uL
Gene Name TMEM150
Gene Alias FLJ90024|TM6P1
Gene Description transmembrane protein 150
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VMNHHVCPVENWSYNESCPPDPAEQGGPKTCCTLDDVPLISKCGSYP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM150.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 129303
Iso type IgG

Enviar un mensaje


TMEM150 polyclonal antibody

TMEM150 polyclonal antibody