KIAA1305 polyclonal antibody
  • KIAA1305 polyclonal antibody

KIAA1305 polyclonal antibody

Ref: AB-PAB21181
KIAA1305 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KIAA1305.
Información adicional
Size 100 uL
Gene Name KIAA1305
Gene Alias FLJ11811
Gene Description KIAA1305
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PNLLALQLSDSTLADIIARLQAGQKLSGSSPFSSAFNSLSLDKESGLLMFKGDKKPRVWVVPTQLRRDLIFSVHDVPLGAHQRPEETYKKLRLLGWWPGMQEHVKDYCRSCLFCIPRNLIGSELKVIES
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KIAA1305.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57523
Iso type IgG

Enviar un mensaje


KIAA1305 polyclonal antibody

KIAA1305 polyclonal antibody