GGNBP2 polyclonal antibody
  • GGNBP2 polyclonal antibody

GGNBP2 polyclonal antibody

Ref: AB-PAB21179
GGNBP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GGNBP2.
Información adicional
Size 100 uL
Gene Name GGNBP2
Gene Alias DIF-3|DIF3|FLJ21230|FLJ22561|FLJ42090|LCRG1|LZK1|ZFP403|ZNF403
Gene Description gametogenetin binding protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VLRAYNILIGELDCSKEKGYCAALYEGLRCCPHERHIHVCCETDFIAHLLGRAEPEFAGGRRERHAKTIDIAQEEVLTCLGIHLYERLHRIWQKLRAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GGNBP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79893
Iso type IgG

Enviar un mensaje


GGNBP2 polyclonal antibody

GGNBP2 polyclonal antibody