PPM1E polyclonal antibody
  • PPM1E polyclonal antibody

PPM1E polyclonal antibody

Ref: AB-PAB21168
PPM1E polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPM1E.
Información adicional
Size 100 uL
Gene Name PPM1E
Gene Alias DKFZp781F1422|KIAA1072|POPX1|PP2CH
Gene Description protein phosphatase 1E (PP2C domain containing)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq EVEGESLDLCLQQLYKYNCPSFLAAALARATSDEVLQSDLSAHYIPKETDGTEGTVEIETVKLARSVFSKLHEI
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPM1E.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22843
Iso type IgG

Enviar un mensaje


PPM1E polyclonal antibody

PPM1E polyclonal antibody