TOX polyclonal antibody
  • TOX polyclonal antibody

TOX polyclonal antibody

Ref: AB-PAB21163
TOX polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TOX.
Información adicional
Size 100 uL
Gene Name TOX
Gene Alias KIAA0808|TOX1
Gene Description thymocyte selection-associated high mobility group box
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQN
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TOX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9760
Iso type IgG

Enviar un mensaje


TOX polyclonal antibody

TOX polyclonal antibody