TMEM68 polyclonal antibody
  • TMEM68 polyclonal antibody

TMEM68 polyclonal antibody

Ref: AB-PAB21160
TMEM68 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM68.
Información adicional
Size 100 uL
Gene Name TMEM68
Gene Alias FLJ32370|MGC87778
Gene Description transmembrane protein 68
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PGFSLLLDVFCALHGPREKCVEILRSGHLLAISPGGVREALISDETYNIVWGHRRGFAQVAIDAKVTKNAVQALIDKHQRIP
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM68.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 137695
Iso type IgG

Enviar un mensaje


TMEM68 polyclonal antibody

TMEM68 polyclonal antibody