RRP1B polyclonal antibody
  • RRP1B polyclonal antibody

RRP1B polyclonal antibody

Ref: AB-PAB21152
RRP1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RRP1B.
Información adicional
Size 100 uL
Gene Name RRP1B
Gene Alias KIAA0179|NNP1L|Nnp1|RRP1
Gene Description ribosomal RNA processing 1 homolog B (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SISQLSFAEDISADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAAPSLEQNRGREPEASGLKALKARVAEPGAEATSSTG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RRP1B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23076
Iso type IgG

Enviar un mensaje


RRP1B polyclonal antibody

RRP1B polyclonal antibody