LY6K polyclonal antibody
  • LY6K polyclonal antibody

LY6K polyclonal antibody

Ref: AB-PAB21148
LY6K polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LY6K.
Información adicional
Size 100 uL
Gene Name LY6K
Gene Alias FLJ35226|HSJ001348
Gene Description lymphocyte antigen 6 complex, locus K
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq TDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LY6K.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54742
Iso type IgG

Enviar un mensaje


LY6K polyclonal antibody

LY6K polyclonal antibody