TMEM131 polyclonal antibody
  • TMEM131 polyclonal antibody

TMEM131 polyclonal antibody

Ref: AB-PAB21147
TMEM131 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM131.
Información adicional
Size 100 uL
Gene Name TMEM131
Gene Alias CC28|KIAA0257|PRO1048|RW1|YR-23
Gene Description transmembrane protein 131
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DFGTLRTQDLPKVLNLHLLNSGTKDVPITSVRPTPQNDAITVHFKPITLKASESKYTKVASISFDASKAKKPSQFSGKITVKAKEKSYSKLEIPYQAEVLDGYLGFDHAATLFHIRDSPADPVERPIYLTNTFSFAIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM131.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23505
Iso type IgG

Enviar un mensaje


TMEM131 polyclonal antibody

TMEM131 polyclonal antibody