C11orf48 polyclonal antibody
  • C11orf48 polyclonal antibody

C11orf48 polyclonal antibody

Ref: AB-PAB21117
C11orf48 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf48.
Información adicional
Size 100 uL
Gene Name C11orf48
Gene Alias MGC2477
Gene Description chromosome 11 open reading frame 48
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LVPGRSKEDGLWTRNSPGSSQHPESPRLPNPLWDRGKIGKVEGHQHIQDFSQKSHLPSIVVESSEVNEESGDLHLPHEELLLLTDGEEEDAEAFFQDQSE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf48.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79081
Iso type IgG

Enviar un mensaje


C11orf48 polyclonal antibody

C11orf48 polyclonal antibody