TRAK1 polyclonal antibody
  • TRAK1 polyclonal antibody

TRAK1 polyclonal antibody

Ref: AB-PAB21104
TRAK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TRAK1.
Información adicional
Size 100 uL
Gene Name TRAK1
Gene Alias OIP106
Gene Description trafficking protein, kinesin binding 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELEDKYAECMEMLHEAQEELKNLRNKTMPNTTSRRYHSLGLFPMDSLAAEIEGTMRKELQLEEAESPDITHQKRVFETVRNINQVVKQRSLTPSPMNIPGSNQSSAMNSLLSSCVSTPRSSFYGSDIGNVVLDNKTNSIILET
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TRAK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22906
Iso type IgG

Enviar un mensaje


TRAK1 polyclonal antibody

TRAK1 polyclonal antibody