SELENBP1 polyclonal antibody
  • SELENBP1 polyclonal antibody

SELENBP1 polyclonal antibody

Ref: AB-PAB21102
SELENBP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SELENBP1.
Información adicional
Size 100 uL
Gene Name SELENBP1
Gene Alias FLJ13813|LPSB|SP56|hSBP|hSP56
Gene Description selenium binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq IEPKDIHAKCELAFLHTSHCLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVLRDGFNPADV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SELENBP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8991
Iso type IgG

Enviar un mensaje


SELENBP1 polyclonal antibody

SELENBP1 polyclonal antibody