SLCO1B3 polyclonal antibody
  • SLCO1B3 polyclonal antibody

SLCO1B3 polyclonal antibody

Ref: AB-PAB21099
SLCO1B3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLCO1B3.
Información adicional
Size 100 uL
Gene Name SLCO1B3
Gene Alias LST-3TM13|LST3|OATP1B3|OATP8|SLC21A8
Gene Description solute carrier organic anion transporter family, member 1B3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QGKDTKASDNERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLCO1B3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 28234
Iso type IgG

Enviar un mensaje


SLCO1B3 polyclonal antibody

SLCO1B3 polyclonal antibody