FAM118A polyclonal antibody
  • FAM118A polyclonal antibody

FAM118A polyclonal antibody

Ref: AB-PAB21091
FAM118A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM118A.
Información adicional
Size 100 uL
Gene Name FAM118A
Gene Alias C22orf8|FLJ20635
Gene Description family with sequence similarity 118, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VTQDAEVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVLKENEDHFFKHQADMLLHGIKVVSYGDCFDHFPGYVQDLATQICKQQSPDADRVDSTTLLGNACQDCAKRKLEENGIE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM118A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55007
Iso type IgG

Enviar un mensaje


FAM118A polyclonal antibody

FAM118A polyclonal antibody