RREB1 polyclonal antibody
  • RREB1 polyclonal antibody

RREB1 polyclonal antibody

Ref: AB-PAB21083
RREB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RREB1.
Información adicional
Size 100 uL
Gene Name RREB1
Gene Alias FINB|HNT|LZ321|RREB-1|Zep-1
Gene Description ras responsive element binding protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ATTDTNKFSPFLQTAEDNTQDEVAGAPADHHGPSDEEQGSPPEDKLLRAKRNSYTNCLQKITCPHCPRVFPWASSLQRHMLTHTGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTIRRAPPLSNN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RREB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6239
Iso type IgG

Enviar un mensaje


RREB1 polyclonal antibody

RREB1 polyclonal antibody