UBN2 polyclonal antibody Ver mas grande

UBN2 polyclonal antibody

AB-PAB21075

Producto nuevo

UBN2 polyclonal antibody

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.


Hoja técnica

Size 100 uL
Gene Name UBN2
Gene Alias FLJ25778
Gene Description ubinuclein 2
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SVTNQNVTPFGMLGGLVPVTMPFQFPLEIFGFGTDTAGVTTTSGSTSAAFHHSLTQNLLKGLQPGGAQHAATLSHSPLPAHLQQAFHDGGQSKGDTKLPRKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)<br>Immunofluorescence (1-4 ug/mL)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UBN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254048
Iso type IgG

Más información

Rabbit polyclonal antibody raised against recombinant UBN2.

Consulta sobre un producto

UBN2 polyclonal antibody

UBN2 polyclonal antibody