UBN2 polyclonal antibody
  • UBN2 polyclonal antibody

UBN2 polyclonal antibody

Ref: AB-PAB21075
UBN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UBN2.
Información adicional
Size 100 uL
Gene Name UBN2
Gene Alias FLJ25778
Gene Description ubinuclein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SVTNQNVTPFGMLGGLVPVTMPFQFPLEIFGFGTDTAGVTTTSGSTSAAFHHSLTQNLLKGLQPGGAQHAATLSHSPLPAHLQQAFHDGGQSKGDTKLPRKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UBN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 254048
Iso type IgG

Enviar un mensaje


UBN2 polyclonal antibody

UBN2 polyclonal antibody