FAM174A polyclonal antibody
  • FAM174A polyclonal antibody

FAM174A polyclonal antibody

Ref: AB-PAB21070
FAM174A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM174A.
Información adicional
Size 100 uL
Gene Name FAM174A
Gene Alias MGC17345|TMEM157|UNQ1912
Gene Description family with sequence similarity 174, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq RRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM174A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 345757
Iso type IgG

Enviar un mensaje


FAM174A polyclonal antibody

FAM174A polyclonal antibody