TMEM43 polyclonal antibody
  • TMEM43 polyclonal antibody

TMEM43 polyclonal antibody

Ref: AB-PAB21064
TMEM43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM43.
Información adicional
Size 100 uL
Gene Name TMEM43
Gene Alias ARVC5|ARVD5|DKFZp586G1919|LUMA|MGC3222
Gene Description transmembrane protein 43
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FKSLSLSKLEDPHVDIIRRGDFFYHSENPKYPEVGDLRVSFSYAGLSGDDPDLGPAHVVTVIARQRGDQLVPFSTKSGDTLLLLHHGDFSAEEVFHRELRSNSMKT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM43.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79188
Iso type IgG

Enviar un mensaje


TMEM43 polyclonal antibody

TMEM43 polyclonal antibody