MPP6 polyclonal antibody
  • MPP6 polyclonal antibody

MPP6 polyclonal antibody

Ref: AB-PAB21059
MPP6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MPP6.
Información adicional
Size 100 uL
Gene Name MPP6
Gene Alias PALS2|VAM-1|VAM1|p55T
Gene Description membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARIL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MPP6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51678
Iso type IgG

Enviar un mensaje


MPP6 polyclonal antibody

MPP6 polyclonal antibody