SLC43A1 polyclonal antibody
  • SLC43A1 polyclonal antibody

SLC43A1 polyclonal antibody

Ref: AB-PAB21048
SLC43A1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC43A1.
Información adicional
Size 100 uL
Gene Name SLC43A1
Gene Alias LAT3|PB39|POV1|R00504
Gene Description solute carrier family 43, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC43A1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8501
Iso type IgG

Enviar un mensaje


SLC43A1 polyclonal antibody

SLC43A1 polyclonal antibody