CSRNP2 polyclonal antibody
  • CSRNP2 polyclonal antibody

CSRNP2 polyclonal antibody

Ref: AB-PAB21041
CSRNP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CSRNP2.
Información adicional
Size 100 uL
Gene Name CSRNP2
Gene Alias C12orf2|C12orf22|FAM130A1|FLJ25576|TAIP-12
Gene Description cysteine-serine-rich nuclear protein 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq FNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CSRNP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 81566
Iso type IgG

Enviar un mensaje


CSRNP2 polyclonal antibody

CSRNP2 polyclonal antibody