NOP5/NOP58 polyclonal antibody
  • NOP5/NOP58 polyclonal antibody

NOP5/NOP58 polyclonal antibody

Ref: AB-PAB21038
NOP5/NOP58 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NOP5/NOP58.
Información adicional
Size 100 uL
Gene Name NOP5/NOP58
Gene Alias HSPC120
Gene Description nucleolar protein NOP5/NOP58
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NOP5/NOP58.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51602
Iso type IgG

Enviar un mensaje


NOP5/NOP58 polyclonal antibody

NOP5/NOP58 polyclonal antibody