ZNF251 polyclonal antibody
  • ZNF251 polyclonal antibody

ZNF251 polyclonal antibody

Ref: AB-PAB21030
ZNF251 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF251.
Información adicional
Size 100 uL
Gene Name ZNF251
Gene Alias FLJ34319
Gene Description zinc finger protein 251
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EFREAWGREGKLKERVGNSAGQSLNKPNIHKRVLTEATVGRERSLGERTQECSAFDRNLNLDQNVVRLQRNKTG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF251.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90987
Iso type IgG

Enviar un mensaje


ZNF251 polyclonal antibody

ZNF251 polyclonal antibody