NDRG3 polyclonal antibody
  • NDRG3 polyclonal antibody

NDRG3 polyclonal antibody

Ref: AB-PAB21027
NDRG3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NDRG3.
Información adicional
Size 100 uL
Gene Name NDRG3
Gene Alias FLJ13556
Gene Description NDRG family member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq CAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGD
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NDRG3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57446
Iso type IgG

Enviar un mensaje


NDRG3 polyclonal antibody

NDRG3 polyclonal antibody