ZSWIM5 polyclonal antibody
  • ZSWIM5 polyclonal antibody

ZSWIM5 polyclonal antibody

Ref: AB-PAB21023
ZSWIM5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZSWIM5.
Información adicional
Size 100 uL
Gene Name ZSWIM5
Gene Alias KIAA1511
Gene Description zinc finger, SWIM-type containing 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QLEIYKHQKKELLQRGTTTITNLEGWVGHPLDPIDCLFLTLTEACRLNDDGYLEMSDMNESRPPVYQHVPVAAGSPNSSESYLSLALEVALMG
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZSWIM5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57643
Iso type IgG

Enviar un mensaje


ZSWIM5 polyclonal antibody

ZSWIM5 polyclonal antibody