HHATL polyclonal antibody
  • HHATL polyclonal antibody

HHATL polyclonal antibody

Ref: AB-PAB21017
HHATL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HHATL.
Información adicional
Size 100 uL
Gene Name HHATL
Gene Alias C3orf3|GUP1|KIAA1173|MBOAT3|MSTP002|OACT3
Gene Description hedgehog acyltransferase-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELWHIRAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HHATL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57467
Iso type IgG

Enviar un mensaje


HHATL polyclonal antibody

HHATL polyclonal antibody