SLC4A11 polyclonal antibody
  • SLC4A11 polyclonal antibody

SLC4A11 polyclonal antibody

Ref: AB-PAB21015
SLC4A11 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC4A11.
Información adicional
Size 100 uL
Gene Name SLC4A11
Gene Alias BTR1|CDPD|CDPD1|CHED2|MGC126418|MGC126419|NABC1|dJ794I6.2
Gene Description solute carrier family 4, sodium borate transporter, member 11
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TNTENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLFTDAGAPMRGKVHLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC4A11.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83959
Iso type IgG

Enviar un mensaje


SLC4A11 polyclonal antibody

SLC4A11 polyclonal antibody