MCOLN3 polyclonal antibody
  • MCOLN3 polyclonal antibody

MCOLN3 polyclonal antibody

Ref: AB-PAB21014
MCOLN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MCOLN3.
Información adicional
Size 100 uL
Gene Name MCOLN3
Gene Alias FLJ11006|FLJ36629|MGC71509|TRP-ML3|TRPML3
Gene Description mucolipin 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEPDEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLT
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MCOLN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55283
Iso type IgG

Enviar un mensaje


MCOLN3 polyclonal antibody

MCOLN3 polyclonal antibody