TMEM87A polyclonal antibody
  • TMEM87A polyclonal antibody

TMEM87A polyclonal antibody

Ref: AB-PAB21012
TMEM87A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM87A.
Información adicional
Size 100 uL
Gene Name TMEM87A
Gene Alias DKFZp564G2022
Gene Description transmembrane protein 87A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RPSANNQRFAFSPLSEEEEEDEQKEPMLKESFEGMKMRSTKQEPNGNSKVNKAQEDDLKWVEENVPSSVTDVALPALLDSDEERMITHFE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM87A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25963
Iso type IgG

Enviar un mensaje


TMEM87A polyclonal antibody

TMEM87A polyclonal antibody