PPAPDC2 polyclonal antibody
  • PPAPDC2 polyclonal antibody

PPAPDC2 polyclonal antibody

Ref: AB-PAB21010
PPAPDC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPAPDC2.
Información adicional
Size 100 uL
Gene Name PPAPDC2
Gene Alias FLJ46512|FLJ90191|MGC15483|PSDP|bA6J24.6
Gene Description phosphatidic acid phosphatase type 2 domain containing 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PAHNQMDMFVTLSVDKYSFPSGHATRAALMSR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPAPDC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 403313
Iso type IgG

Enviar un mensaje


PPAPDC2 polyclonal antibody

PPAPDC2 polyclonal antibody