KCNH7 polyclonal antibody
  • KCNH7 polyclonal antibody

KCNH7 polyclonal antibody

Ref: AB-PAB21006
KCNH7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KCNH7.
Información adicional
Size 100 uL
Gene Name KCNH7
Gene Alias ERG3|HERG3|Kv11.3|MGC45986
Gene Description potassium voltage-gated channel, subfamily H (eag-related), member 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DNCKLRRRKLSFESEGEKENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIGKASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSPSALQRAA
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KCNH7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 90134
Iso type IgG

Enviar un mensaje


KCNH7 polyclonal antibody

KCNH7 polyclonal antibody