ATP6V0A4 polyclonal antibody
  • ATP6V0A4 polyclonal antibody

ATP6V0A4 polyclonal antibody

Ref: AB-PAB21000
ATP6V0A4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATP6V0A4.
Información adicional
Size 100 uL
Gene Name ATP6V0A4
Gene Alias A4|ATP6N1B|ATP6N2|MGC130016|MGC130017|RDRTA2|RTA1C|RTADR|STV1|VPH1|VPP2
Gene Description ATPase, H+ transporting, lysosomal V0 subunit a4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RASHRKSQLQASRIQEDATENIEGDSSSPSSRSGQRTSADTHGALDDHGEEFNFGDVFVHQAIHTIEYCLGCISNTAS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATP6V0A4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 50617
Iso type IgG

Enviar un mensaje


ATP6V0A4 polyclonal antibody

ATP6V0A4 polyclonal antibody