ITSN1 polyclonal antibody
  • ITSN1 polyclonal antibody

ITSN1 polyclonal antibody

Ref: AB-PAB20995
ITSN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ITSN1.
Información adicional
Size 100 uL
Gene Name ITSN1
Gene Alias ITSN|MGC134948|MGC134949|SH3D1A|SH3P17
Gene Description intersectin 1 (SH3 domain protein)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWW
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ITSN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6453
Iso type IgG

Enviar un mensaje


ITSN1 polyclonal antibody

ITSN1 polyclonal antibody