FOXK1 polyclonal antibody
  • FOXK1 polyclonal antibody

FOXK1 polyclonal antibody

Ref: AB-PAB20992
FOXK1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FOXK1.
Información adicional
Size 100 uL
Gene Name FOXK1
Gene Alias FLJ14977|FOXK1L
Gene Description forkhead box K1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAKPVAYMPASIVTSQQPAGHAIHVVQQAPTVTMVRVVTTSANSANGYILTSQGAAGGSHDAAGAAVLDLGSEARGLEEKPTIAFATIPAAGGVIQTVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FOXK1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 221937
Iso type IgG

Enviar un mensaje


FOXK1 polyclonal antibody

FOXK1 polyclonal antibody