SLC36A4 polyclonal antibody
  • SLC36A4 polyclonal antibody

SLC36A4 polyclonal antibody

Ref: AB-PAB20973
SLC36A4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC36A4.
Información adicional
Size 100 uL
Gene Name SLC36A4
Gene Alias FLJ38932|PAT4
Gene Description solute carrier family 36 (proton/amino acid symporter), member 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq REELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC36A4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 120103
Iso type IgG

Enviar un mensaje


SLC36A4 polyclonal antibody

SLC36A4 polyclonal antibody