FRRS1 polyclonal antibody
  • FRRS1 polyclonal antibody

FRRS1 polyclonal antibody

Ref: AB-PAB20970
FRRS1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FRRS1.
Información adicional
Size 100 uL
Gene Name FRRS1
Gene Alias SDFR2|SDR2
Gene Description ferric-chelate reductase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SHLTKPFSASDCGNKKFCIRSPLNCDPEKEASCVFLSFTRDDQSVMVEMSGPSKGYLSFALSHDQWMGDDDAYLCIHEDQTVYIQPSHLTGRSHPVMDSRDTLEDMAWRLADGVMQCSFRRNITLPGVKNRFDLNTSYYIFLADGAANDG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FRRS1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 391059
Iso type IgG

Enviar un mensaje


FRRS1 polyclonal antibody

FRRS1 polyclonal antibody