PSMC5 polyclonal antibody
  • PSMC5 polyclonal antibody

PSMC5 polyclonal antibody

Ref: AB-PAB20968
PSMC5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSMC5.
Información adicional
Size 100 uL
Gene Name PSMC5
Gene Alias S8|SUG1|TBP10|TRIP1|p45|p45/SUG
Gene Description proteasome (prosome, macropain) 26S subunit, ATPase, 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSMC5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5705
Iso type IgG

Enviar un mensaje


PSMC5 polyclonal antibody

PSMC5 polyclonal antibody